This is a working overview of freeze-thaw cycle, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-12-21. Anything still debated is marked as such rather than presented as settled.
Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.
Laboratory samples of SR9009 are typically supplied as a white to off-white powder. The compound dissolves readily in organic solvents such as dimethyl sulfoxide and ethanol, while its solubility in water is low. Because of this solubility profile, researchers often prepare concentrated stock solutions in an organic solvent before diluting them into aqueous assay buffers. Light exposure, moisture, and repeated freeze-thaw cycles can degrade many small molecules, so handling procedures usually aim to minimize these factors. Purity is commonly checked before use.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
Analytical methods for SR9009 typically rely on liquid chromatography coupled with tandem mass spectrometry. The technique can separate the parent compound from related substances and detect low concentrations in biological matrices. Urine and blood are common samples in anti-doping testing, while in vitro studies may use cell culture media. Rapid metabolism and low expected concentrations make method validation important for reliable identification. Exact metabolite patterns can vary by species and are not fully mapped.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Typical for research-grade material |
| Solubility | Soluble in DMSO and ethanol; low aqueous solubility | Organic stock solutions are common |
| Typical storage temperature | -20 °C or lower | Protect from light and moisture |
| Common analytical method | LC-MS/MS | Used for detection and confirmation |
| Common synonyms | SR9009; Stenabolic | Stenabolic is an informal name |
Several misconceptions surround SR9009. It is often described as a SARM, a steroid, or an exercise pill, but its known target is the REV-ERB receptor family. Rodent studies have examined exercise capacity and metabolic markers, yet human outcomes remain unproven. Oral bioavailability appears low in animals, and human pharmacokinetics are not well characterized. Online products may contain impurities or different compounds, so identity and purity testing are important for research use.
Analytical chemists detect SR9009 with liquid chromatography-tandem mass spectrometry, commonly abbreviated LC-MS/MS. Sample preparation may involve protein precipitation, liquid-liquid extraction, or solid-phase extraction before analysis. Laboratories can target the parent compound or its metabolites, depending on the matrix and the purpose of testing. Anti-doping methods require sensitive and specific assays because concentrations in biological samples can be low. Reference standards and validated methods are essential for reliable identification and quantification.
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
Quality control for research materials includes identity confirmation by nuclear magnetic resonance and purity assessment by high-performance liquid chromatography. Mass spectrometry provides molecular weight confirmation and can detect related impurities. Purchasers should request a certificate of analysis that lists lot-specific data. Online products advertised for human use often lack such documentation. Distinguishing legitimate research material from mislabeled or contaminated samples is a recurring challenge in independent testing, and independent laboratories may use orthogonal methods to verify identity.
Detection of SR9009 in biological samples usually relies on liquid chromatography coupled to tandem mass spectrometry. This approach separates the compound from matrix components and identifies it by mass transitions. Because SR9009 can undergo metabolism, laboratories often look for both parent drug and specific metabolites. Sample preparation may involve protein precipitation or solid-phase extraction. Method validation examines sensitivity, carryover, and interference from related substances, and reference standards are required for accurate calibration.
Storage recommendations for SR9009 reference material typically specify a freezer at -20 °C or lower, with protection from moisture and light. Repeated freeze-thaw cycles can degrade small molecules and introduce variability. Stock solutions in dimethyl sulfoxide are often aliquoted to avoid repeated handling. Stability studies may examine degradation under heat, humidity, and light exposure. The compound's thiophene and nitro groups can participate in reactions that alter analytical signals over time, so such changes affect quantitative results.
For long-term storage, SR9009 is typically kept as a solid at low temperature, protected from moisture and light. Desiccated conditions limit hydrolysis, while opaque containers reduce photochemical breakdown. Solutions are less stable than solids and are often stored frozen in aliquots to avoid repeated freeze-thaw cycles. Stability data are not standardized across all suppliers, so users should rely on certificate-of-analysis information when available. Degradation may appear as color change, precipitate, or decreased chromatographic purity.
Laboratory identification of SR9009 typically relies on chromatographic separation coupled to mass spectrometry, often with ultraviolet detection as a secondary check. Nuclear magnetic resonance spectroscopy can confirm molecular structure when a reference standard is available. Because many suppliers sell the compound as a research chemical, independent identity testing is important for experimental reproducibility. A single retention time is not sufficient proof of identity, especially when related compounds may be present. Purity assessments usually report a percentage based on area normalization.
SR9009 is generally described as poorly soluble in water and more soluble in organic solvents such as dimethyl sulfoxide and ethanol. Stock solutions are commonly prepared in an organic solvent before dilution into an aqueous buffer or vehicle. Precipitation can occur if the organic fraction is reduced too quickly or if the final concentration exceeds the compound's solubility limit. Sonication or gentle warming may aid dissolution in some protocols, but excessive heat can promote degradation. Container material and pH can also influence observed solubility.
SR9009 is frequently discussed alongside other REV-ERB ligands, including synthetic agonists and natural heme-related molecules. Its selectivity for REV-ERB over related nuclear receptors has been measured in binding and reporter assays, though off-target activity at higher concentrations is possible. The compound is prohibited in sport by the World Anti-Doping Agency, and it is not approved for any medical use in major jurisdictions. Products sold online may be labeled as research chemicals, and their identity and purity are not guaranteed by regulatory review.
SR9009 is a synthetic small molecule that acts on the nuclear receptors REV-ERBα and REV-ERBβ. These receptors are part of the circadian clock machinery and normally repress transcription of certain target genes. In laboratory research, SR9009 is used as a chemical tool to study how REV-ERB activity influences metabolism, inflammation, and daily biological rhythms. The compound is not an approved medicine, and its effects in humans remain largely uncharacterized. It is often described as an investigational agent rather than a therapeutic product.
REV-ERB proteins typically suppress gene expression by recruiting corepressor complexes to DNA response elements. SR9009 binds these receptors and strengthens that repressive action in cell-based assays. Studies in rodents have reported changes in lipid handling, mitochondrial function, and exercise capacity after treatment. Such findings are often cited as evidence for metabolic effects, but species differences and limited pharmacokinetic data make direct translation to humans uncertain. Researchers continue to examine which effects are robust and which depend on specific experimental conditions.
The reduced ability of the kidneys to excrete sodium and water causes retention (medicine) of these substances and thus an increase in blood volume, which ultimately leads to an increase in blood pressure. About two thirds of all cats with CNE are affected. High blood pressure in turn leads to increased connective tissue formation. A potassium deficiency or excess calcium secondary to other kidney damage also causes further damage to the kidney tissue.
The Kizil Caves are "the earliest representative grottoes in China". The art of the Kizil Caves is thought to have influenced cave art at Dunhuang, in the Mogao Caves, as early as during the Northern Liang dynasty (421–439 CE), and pictorial arts in China thereafter. According to historian Daniel C. Waugh:
The suit contains an on-board computer system that constantly monitors the user's health and vital signs, and reacts to any changes in the user's condition. It also projects a heads-up display (HUD) which displays Gordon's health and suit charge level, remaining ammunition, and a crosshair. As a means of immersing the player in the role, Gordon never speaks, and there are no cutscenes or mission briefings—all action is viewed through Gordon's eyes, with the player retaining control of Gordon's actions at nearly all times. Gordon does not appear to wear the helmet, although other dead scientists that appear throughout the game have one. The images of Gordon are only seen on the game's cover and menu pages, and also in advertisements, making them marketing tools rather than pictures of what Gordon is "really like". Gabe Newell has stated that Valve sees no reason to give Gordon a voice. In Half-Life, Gordon wears the Mark IV suit. Later in the game, the suit is equipped with an optional long-jump module so Gordon can leap great distances. It is charged using power modules throughout Black Mesa. In Half-Life 2 Gordon receives the upgraded Mark V suit, which lacks the long-jump module but gains several new abilities. It features a visual zooming capability, limited sprinting, an anti-venom injector, an optional ammo and a health counter on the crosshair, and has been modified to use Combine power nodes to charge the suit.
The beef hormone controversy or beef hormone dispute is a disagreement over the use of growth hormones in beef production. In 1989, the European Communities banned the import of meat that contained artificial beef growth hormones, although they were approved for use in the United States. In 2003 estradiol-17β was permanently banned, while provisionally banning five others. World Trade Organization (WTO) rules permit such bans, but only where a signatory presents valid scientific evidence that the ban is a health and safety measure. Canada and the United States opposed this ban, taking the EU to the WTO Dispute Settlement Body. In 1997, the WTO Dispute Settlement Body ruled against the EU. It remains one of the most intractable agricultural trade controversies since the establishment of the WTO. It is not the same as the UK–EU dispute over bovine spongiform encephalopathy, although both have been termed the "beef war".
VfB Leipzig were immediately successful at their chosen sport and made their way to the first German national championship final held in 1903. Their opponents were DFC Prag, a German-Jewish side from Prague, which was then part of Austria-Hungary. The DFB had invited "German" clubs of this sort from other countries to boost numbers in their new national association. DFC Prag had made their way to the final under circumstances that had allowed them to avoid playing a single playoff match, while VfB Leipzig had come through some hard-fought matches. Arriving in Hamburg for the match, the heavily favoured Pragers took themselves off on an ill-advised pub crawl the night before the contest and so arrived on the pitch in less than ideal match shape. The contest was delayed by half an hour as officials scrambled to find a football that was in good condition. The host, FC 93 Altona Hamburg, provided a new ball, and 11 minutes in, DFC Prag scored the first goal. At the end of the first half, the score stood at 1–1, but VfB Leipzig then pulled away to emerge as the first winners of the Viktoria Meisterschaftstrophäe ("Victoria Championship Trophy"), representative of German football supremacy, on the strength of a decisive 7–2 victory. VfB Leipzig played themselves into another final appearance in 1904, but the match was never contested. A protest by FV Karlsruhe over their disputed semi-final with Britannia Berlin was never resolved, and the DFB called off the final only hours before its scheduled start. There would be no champion that year.
Sources: en.wikipedia.org
==== First scientific synthetic dye: picric acid ==== The first synthetic dye was picric acid. It was prepared in a laboratory in 1771, and commercially produced by M. Guinon in Lyon in 1845. It dyed silk fabric yellow; however the color fastness properties were not good, thus it had very limited commercial success. It was, however, purchased in limited amounts by French dyers.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
All committees have an allotted budget to which they must adhere. Any committee may start a project. If a project's spending becomes too much for a committee to continue funding, it must take the issue to the Project Committee. The project committee either increases the budget or decides on an external funding plan. The Bureau and Executive Committee oversee operations of the other committees.
=== Negative chemical ionization === Chemical ionization for gas phase analysis is either positive or negative. Almost all neutral analytes can form positive ions through the reactions described above. In order to see a response by negative chemical ionization (NCI, also NICI), the analyte must be capable of producing a negative ion (stabilize a negative charge) for example by electron capture ionization. Because not all analytes can do this, using NCI provides a certain degree of selectivity that is not available with other, more universal ionization techniques (EI, PCI). NCI can be used for the analysis of compounds containing acidic groups or electronegative elements (especially halogens).Moreover, negative chemical ionization is more selective and demonstrates a higher sensitivity toward oxidizing agents and alkylating agents. Because of the high electronegativity of halogen atoms, NCI is a common choice for their analysis. This includes many groups of compounds, such as PCBs, pesticides, and fire retardants. Most of these compounds are environmental contaminants, thus much of the NCI analysis that takes place is done under the auspices of environmental analysis. In cases where very low limits of detection are needed, environmental toxic substances such as halogenated species, oxidizing and alkylating agents are frequently analyzed using an electron capture detector coupled to a gas chromatograph.
Hypoxic-anoxic events may affect the fetus at various stages of fetal development, during labor and delivery, and in the postnatal period. Sometimes, even an infant that is still in the womb may exhibit signs of HIE or other hypoxic-ischemic injury. Fetal distress is one of the most common signs of HIE or other oxygen-depriving event. Other problems during pregnancy may include preeclampsia, maternal diabetes with vascular disease, congenital fetal infections, substance/alcohol use, severe fetal anemia, cardiac disease, lung malformations, or problems with blood flow to the placenta. Problems during labor and delivery can include umbilical cord occlusion, torsion or prolapse, rupture of the placenta or uterus, excessive bleeding from the placenta, abnormal fetal position such as the breech position, prolonged late stages of labor, or very low blood pressure in the mother. Problems after delivery can include severe prematurity, severe lung or heart disease, serious infections, trauma to the brain or skull, congenital malformations of the brain or very low blood pressure in the baby and due to suffocation in cases of Münchausen syndrome by proxy. The severity of a neonatal hypoxic-ischaemic brain injury may be assessed using Sarnat staging, which is based on clinical presentation and EEG findings, and also using MRI. Signs and symptoms of HIE may include:
Sources: en.wikipedia.org
Research-grade SR9009 is typically stored frozen at about minus twenty degrees Celsius, protected from light and moisture. Stock solutions are often kept in aliquots to avoid repeated freeze-thaw cycles. Specific storage conditions should follow the supplier's documentation.
Liquid chromatography with tandem mass spectrometry is widely used to detect and confirm SR9009 in laboratory samples. The technique offers high sensitivity and can distinguish the target compound from related substances. Nuclear magnetic resonance and ultraviolet detection may support identity and purity checks.
Online products labeled as SR9009 may vary in identity, purity, and actual content. Independent testing helps confirm that a sample matches its label and does not contain unexpected contaminants. This is important for reproducible research and for interpreting experimental results.
No. It is an investigational compound without approved therapeutic indications. It is sold for research purposes only in many jurisdictions.